Sponsored Content
Top Forums Shell Programming and Scripting Split file into multiple files using awk Post 302987296 by RudiC on Thursday 8th of December 2016 05:03:38 AM
Old 12-08-2016
Try
Code:
awk '
/^F/            {HD = $0
                 next
                }

/^THEAD/        {if (FN)        {printf "FTAIL%010d%010d" ORS, LN+2, LN > FN
                                 close (FN)
                                 LN = 0
                                }
                 FN = "RTLOG_test" ++f
                 print HD > FN
                }

                {print >> FN
                 LN++
                }

END             {printf "FTAIL%010d%010d" ORS, LN+2, LN > FN
                }
' file
cf RTLOG_test*
RTLOG_test1:
FHEAD0000000001RTLG20161205110959201612055019
THEAD......
TCUST.....
TITEM....
TTEND...
TTAIL...
FTAIL00000000070000000005
RTLOG_test2:
FHEAD0000000001RTLG20161205110959201612055019
THEAD......
TCUST.....
TITEM....
TITEM.....
TTEND...
TTAIL...
FTAIL00000000080000000006

This User Gave Thanks to RudiC For This Post:
 

10 More Discussions You Might Find Interesting

1. Shell Programming and Scripting

Split a file into multiple files

I have a file ehich has multiple create statements as create abc 123 one two create xyz 456 four five create nnn 666 six four I want to separte each create statement in seperate files (3 Replies)
Discussion started by: glamo_2312
3 Replies

2. UNIX for Dummies Questions & Answers

split a file into multiple files

Hi All, I have a file ABC.txt and I need to split this file on every 250 rows. And the file name should be ABC1.txt , ABC2.txt and so on. I tried with split command split -l 250 <filename> '<filename>' but the file name returned was ABC.txtaa ABC.txtab. Please... (8 Replies)
Discussion started by: kumar66
8 Replies

3. Shell Programming and Scripting

Split a file into multiple files

Hi, i have a file like this: 1|2|3|4|5| 1|2|8|4|6| Trailer1||||| 1|2|3| Trailer2||| 3|4|5|6| 3|4|5|7| 3|4|5|8| Trailer2||| I want to generate 3 files out of this based on the trailer record. Trailer record string can be different for each file or it may be same for one or two. No... (24 Replies)
Discussion started by: pparthji
24 Replies

4. Shell Programming and Scripting

Split line to multiple files Awk/Sed/Shell Script help

Hi, I need help to split lines from a file into multiple files. my input look like this: 13 23 45 45 6 7 33 44 55 66 7 13 34 5 6 7 87 45 7 8 8 9 13 44 55 66 77 8 44 66 88 99 6 I want to split every 3 lines from this file to be written to individual files. (3 Replies)
Discussion started by: saint2006
3 Replies

5. Shell Programming and Scripting

Split file into multiple files

Hi I have a file that has multiple sequences; the sequence name is the line starting with '>'. It looks like below: infile.txt: >HE_ER tttggtgccttgactcggattgggggacctcccttgggagatcaatcccctgtcctcctgctctttgctc cgtgaaaaggatccacctatgacctctagtcctcagacccaccagcccaaggaacatctcaccaatttca >M7B_Ho_sap... (2 Replies)
Discussion started by: jdhahbi
2 Replies

6. Shell Programming and Scripting

split file into multiple files

Hi, I have a file of the following syntax that has around 120K records that are tab separated. input.txt abc def klm 20 76 . + . klm_mango unix_00000001; abc def klm 83 84 . + . klm_mango unix_0000103; abc def klm 415 439 . + . klm_mango unix_00001043; I am looking for an awk oneliner... (2 Replies)
Discussion started by: jacobs.smith
2 Replies

7. Shell Programming and Scripting

How to split file into multiple files using awk based on 1 field in the file?

Good day all I need some helps, say that I have data like below, each field separated by a tab DATE NAME ADDRESS 15/7/2012 LX a.b.c 15/7/2012 LX1 a.b.c 16/7/2012 AB a.b.c 16/7/2012 AB2 a.b.c 15/7/2012 LX2 a.b.c... (2 Replies)
Discussion started by: alexyyw
2 Replies

8. Shell Programming and Scripting

awk script to split file into multiple files based on many columns

So I have a space delimited file that I'd like to split into multiple files based on multiple column values. This is what my data looks like 1bc9A02 1 10 1000 FTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPELEHHHHHH 1ku1A02 1 10... (9 Replies)
Discussion started by: viored
9 Replies

9. Shell Programming and Scripting

Split a big file into multiple files using awk

this thread is a continuation from previous thread https://www.unix.com/shell-programming-and-scripting/223901-split-big-file-into-multiple-files-based-first-four-characters.html ..I am using awk to split file and I have a syntax error while executing the below code I am using AIX 7.2... (4 Replies)
Discussion started by: etldev
4 Replies

10. Shell Programming and Scripting

awk to split file using multiple deliminators

I am trying to use awk to split a input file using multiple delimiters :-|. The input file is just one field and the output is 6 tab-delimited fields. The awk below does run and works as expected until I add the third delimiter |, which gives the current output below. I am not sure what is... (6 Replies)
Discussion started by: cmccabe
6 Replies
AWK(1)							      General Commands Manual							    AWK(1)

NAME
awk - pattern scanning and processing language SYNOPSIS
awk [ -Fc ] [ prog ] [ file ] ... DESCRIPTION
Awk scans each input file for lines that match any of a set of patterns specified in prog. With each pattern in prog there can be an asso- ciated action that will be performed when a line of a file matches the pattern. The set of patterns may appear literally as prog, or in a file specified as -f file. Files are read in order; if there are no files, the standard input is read. The file name `-' means the standard input. Each line is matched against the pattern portion of every pattern-action statement; the associated action is performed for each matched pattern. An input line is made up of fields separated by white space. (This default can be changed by using FS, vide infra.) The fields are denoted $1, $2, ... ; $0 refers to the entire line. A pattern-action statement has the form pattern { action } A missing { action } means print the line; a missing pattern always matches. An action is a sequence of statements. A statement can be one of the following: if ( conditional ) statement [ else statement ] while ( conditional ) statement for ( expression ; conditional ; expression ) statement break continue { [ statement ] ... } variable = expression print [ expression-list ] [ >expression ] printf format [ , expression-list ] [ >expression ] next # skip remaining patterns on this input line exit # skip the rest of the input Statements are terminated by semicolons, newlines or right braces. An empty expression-list stands for the whole line. Expressions take on string or numeric values as appropriate, and are built using the operators +, -, *, /, %, and concatenation (indicated by a blank). The C operators ++, --, +=, -=, *=, /=, and %= are also available in expressions. Variables may be scalars, array elements (denoted x[i]) or fields. Variables are initialized to the null string. Array subscripts may be any string, not necessarily numeric; this allows for a form of associative memory. String constants are quoted "...". The print statement prints its arguments on the standard output (or on a file if >file is present), separated by the current output field separator, and terminated by the output record separator. The printf statement formats its expression list according to the format (see printf(3)). The built-in function length returns the length of its argument taken as a string, or of the whole line if no argument. There are also built-in functions exp, log, sqrt, and int. The last truncates its argument to an integer. substr(s, m, n) returns the n-character sub- string of s that begins at position m. The function sprintf(fmt, expr, expr, ...) formats the expressions according to the printf(3) for- mat given by fmt and returns the resulting string. Patterns are arbitrary Boolean combinations (!, ||, &&, and parentheses) of regular expressions and relational expressions. Regular expressions must be surrounded by slashes and are as in egrep. Isolated regular expressions in a pattern apply to the entire line. Regu- lar expressions may also occur in relational expressions. A pattern may consist of two patterns separated by a comma; in this case, the action is performed for all lines between an occurrence of the first pattern and the next occurrence of the second. A relational expression is one of the following: expression matchop regular-expression expression relop expression where a relop is any of the six relational operators in C, and a matchop is either ~ (for contains) or !~ (for does not contain). A condi- tional is an arithmetic expression, a relational expression, or a Boolean combination of these. The special patterns BEGIN and END may be used to capture control before the first input line is read and after the last. BEGIN must be the first pattern, END the last. A single character c may be used to separate the fields by starting the program with BEGIN { FS = "c" } or by using the -Fc option. Other variable names with special meanings include NF, the number of fields in the current record; NR, the ordinal number of the current record; FILENAME, the name of the current input file; OFS, the output field separator (default blank); ORS, the output record separator (default newline); and OFMT, the output format for numbers (default "%.6g"). EXAMPLES
Print lines longer than 72 characters: length > 72 Print first two fields in opposite order: { print $2, $1 } Add up first column, print sum and average: { s += $1 } END { print "sum is", s, " average is", s/NR } Print fields in reverse order: { for (i = NF; i > 0; --i) print $i } Print all lines between start/stop pairs: /start/, /stop/ Print all lines whose first field is different from previous one: $1 != prev { print; prev = $1 } SEE ALSO
lex(1), sed(1) A. V. Aho, B. W. Kernighan, P. J. Weinberger, Awk - a pattern scanning and processing language BUGS
There are no explicit conversions between numbers and strings. To force an expression to be treated as a number add 0 to it; to force it to be treated as a string concatenate "" to it. AWK(1)
All times are GMT -4. The time now is 02:35 PM.
Unix & Linux Forums Content Copyright 1993-2022. All Rights Reserved.
Privacy Policy