Linux and UNIX Man Pages

Linux & Unix Commands - Search Man Pages

gitg(1) [debian man page]

GITG(1) 						      General Commands Manual							   GITG(1)

NAME
gitg - Git repository viewer SYNOPSIS
gitg [options] [repository] [<refspec>] DESCRIPTION
gitg is a GitX clone for GNOME/gtk+. It aims at being a small, fast and convenient tool to visualize git history and actions that benefit from a graphical presentation. OPTIONS
-c,--commit Open gitg in commit view -?,--help Show the help message [repository] Load the repository at repository in gitg. If unspecified, gitg will try to open the repository at the current working direc- tory [<refspec>] Populate the history view of gitg using the specified <refspec> which has the same format as used with git log (Example: gitg --left-right HEAD..FETCH_HEAD) AUTHORS
Jesse van den Kieboom <jesse@icecrew.nl> 22 Jun 2008 GITG(1)

Check Out this Related Man Page

GIT-REQUEST-PULL(1)                                                 Git Manual                                                 GIT-REQUEST-PULL(1)

NAME
git-request-pull - Generates a summary of pending changes SYNOPSIS
git request-pull [-p] <start> <url> [<end>] DESCRIPTION
Generate a request asking your upstream project to pull changes into their tree. The request, printed to the standard output, begins with the branch description, summarizes the changes and indicates from where they can be pulled. The upstream project is expected to have the commit named by <start> and the output asks it to integrate the changes you made since that commit, up to the commit named by <end>, by visiting the repository named by <url>. OPTIONS
-p Include patch text in the output. <start> Commit to start at. This names a commit that is already in the upstream history. <url> The repository URL to be pulled from. <end> Commit to end at (defaults to HEAD). This names the commit at the tip of the history you are asking to be pulled. When the repository named by <url> has the commit at a tip of a ref that is different from the ref you have locally, you can use the <local>:<remote> syntax, to have its local name, a colon :, and its remote name. EXAMPLE
Imagine that you built your work on your master branch on top of the v1.0 release, and want it to be integrated to the project. First you push that change to your public repository for others to see: git push https://git.ko.xz/project master Then, you run this command: git request-pull v1.0 https://git.ko.xz/project master which will produce a request to the upstream, summarizing the changes between the v1.0 release and your master, to pull it from your public repository. If you pushed your change to a branch whose name is different from the one you have locally, e.g. git push https://git.ko.xz/project master:for-linus then you can ask that to be pulled with git request-pull v1.0 https://git.ko.xz/project master:for-linus GIT
Part of the git(1) suite Git 2.17.1 10/05/2018 GIT-REQUEST-PULL(1)
Man Page

5 More Discussions You Might Find Interesting

1. Shell Programming and Scripting

How to tail -f multi logfile in 1 shell script.?

Hello, How to tail -f multi logfile from multi path in 1 shell script. File & Path /usr/home/localmode/mode110l/log/logic/number110/digit110_digit110m4_2013050210.txt /usr/home/localmode/mode103l/log/logic/number103/digit103_digit103m4_2013050210.txt... (4 Replies)
Discussion started by: ooilinlove
4 Replies

2. Red Hat

[Solved] Cannot install git on RHEL 6

Hi, I am trying to install git on RHEL 6. From the research I have done I should be able to just say: sudo yum install git but it is not working (it says no package git is available). I am fairly new to linux and cannot figure this out. Thanks for any help you can provide. (7 Replies)
Discussion started by: dsabol
7 Replies

3. Shell Programming and Scripting

Controlling user input

I'm trying to use a bash script for a psych experiment that involves listening to sound files and responding. If I have something like the code below, how can I make sure that a key press is assigned to RESPONSE only after the second echo statement? for i in 1 2 3; do echo "Ready?" sleep 2 ... (10 Replies)
Discussion started by: darwin_886
10 Replies

4. Shell Programming and Scripting

Shorten header of protein sequences in fasta file to only organism name

I have a fasta file as follows >sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens OX=9606 GN=STAB2 PE=1 SV=3 MMLQHLVIFCLGLVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTM ITSGSVGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPRCCPGRWGPDCIECPGGAGSPC NGRGSCAEGMEGNGTCSCQEGFGGTACETCADDNLFGPSCSSVCNCVHGVCNSGLDGDGT... (3 Replies)
Discussion started by: jerrild
3 Replies

5. Shell Programming and Scripting

Adding sequential index to duplicate strings

I have a text file in the following format >Homo sapiens KQKCLYNLPFKRNLEGCRERCSLVIQIPRCCKGYFGRDCQACPGGPDAPCNNRGVCLDQY SATGECKCNTGFNGTACEMCWPGRFGPDCLPCGCSDHGQCDDGITGSGQCLCETGWTGPS CDTQAVLPAVCTPPCSAHATCKENNTCECNLDYEGDGITCTVVDFCKQDNGGCAKVARCS... (2 Replies)
Discussion started by: jerrild
2 Replies