Linux and UNIX Man Pages

Linux & Unix Commands - Search Man Pages

gtv(1) [debian man page]

GTV(1)							      General Commands Manual							    GTV(1)

NAME
gtv - MPEG audio (MP3) and video (MPEG-1) player with GTK+ GUI SYNOPSIS
gtv file DESCRIPTION
gtv is an MPEG audio and video player that uses the SDL MPEG Player Library. It can play back MPEG audio (layer 1, 2 and 3), MPEG video (MPEG-1) and MPEG system (audio and video combined) files. MPEG-2 video files (as found on DVDs) are not supported. The video player works best on a 16 bit color depth X11 display, it works on other color depths with reduced speed as well. You'll need a CPU with 300 MHz or more to play back an MPEG system stream with 25 frames per seconds (fps) at full speed. SEE ALSO
SMPEG home page at http://www.lokigames.com/development/smpeg.php3 AUTHOR
The SDL MPEG Player Library was written by Karl Robillard and Sam Lantinga of Loki Entertainment Software. Please report any bugs and/or fixes to smpeg@lokigames.com. This manual page was written by Stefan Gybas <sgybas@debian.org> for the Debian GNU/Linux system, but may be used elsewhere under the GPL. GTV(1)

Check Out this Related Man Page

DVBCUT(1)						      General Commands Manual							 DVBCUT(1)

NAME
dvbcut - Qt application for cutting parts out of DVB streams SYNOPSIS
dvbcut [ -idx indexfile ] [ mpegfile ] dvbcut projectfile dvbcut -generateidx -idx indexfile mpegfile DESCRIPTION
DVBCUT is a Qt application that allows you to select certain parts of an MPEG transport stream (as received via Digital Video Broadcasting, DVB) and save these parts into a single MPEG output file. It follows a ``keyhole surgery'' approach where the input video and audio data is mostly kept unchanged, and only very few frames at the beginning and/or end of the selected range are re-encoded in order to obtain a valid MPEG file. DVBCUT needs to create index information on an MPEG file first. Therefore, when loading an MPEG transport stream file, it also asks you for a filename of an index file. If you choose an existing file, it is loaded and used as index if suitable. (That means, that dvbcut performs some sanity checks on the index itself and also checks if the index describes the chosen MPEG file.) If you select a file which does not yet exist, dvbcut creates the necessary index in place. OPTIONS
-idx indexfile Use indexfile as index. -generateidx Do not show the graphical user interface, only generate an index. AUTHOR
dvbcut was written by Sven Over <svenover@svenover.de>. November 27, 2005 DVBCUT(1)
Man Page

14 More Discussions You Might Find Interesting

1. Shell Programming and Scripting

Modifications to a file

I have a file whose format is shown below. It has a table of numbers. In this case, I have 16 values in 12 rows. I want to select a position in the table, example, the 5th number at row 5. I need to change the value in that position by a certain amount and output the file with the modifiation. ... (6 Replies)
Discussion started by: kristinu
6 Replies

2. IP Networking

Help with iptables

photo... (1 Reply)
Discussion started by: beerpong1
1 Replies

3. UNIX for Dummies Questions & Answers

Backup solution using rsync

Hello All, I am looking at a fast way to script some backups. I am looking at using rsync to do the leg work. I am having a hard time conceiving a script though. I have a tree with subfolders within subfolders. I was looking at the /xd option to parse the tree. Directory of k:\ ... (4 Replies)
Discussion started by: jvamos
4 Replies

4. Solaris

DBCA Issues

I am wondering if someone can help a brother out. I am trying to create a DB using a GUI and when I am about to finish, it gets stuck. I hit finish but nothing happens. Any help from the community will be highly appreciated. ... (0 Replies)
Discussion started by: newborndba
0 Replies

5. AIX

StorWize v3700 and Power8 (S822) AIX, configuration best practice for LUNs?

Hello, We have an Power8 System (S822) and a IBM StorWize v3700 SAN. The OS is AIX 7.1. With this hardware from what I read I need to download/install special SDDPCM drivers, so I did (SDDPCM VERSION 2.6.6.0 (devices.sddpcm.71.rte). I carved my volumes in the StorWize and presented to... (3 Replies)
Discussion started by: c3rb3rus
3 Replies

6. Red Hat

Copy mismatch while copying RHEL DVD to folder

Hi, Here is this weird thing happening here. I mounted RHEL 6.6 DVD on a directoy /a, I am trying to copy it's content to another folder by using command: cp -pr /a/* /new/folder But while I run ls -lrt on both locations it show me difference in number of files. Any specific reason for that.... (5 Replies)
Discussion started by: nixhead
5 Replies

7. AIX

How can I map hdisk# to rhdisk#?

Some storage/disks have been added to an existing AIX 6.1 server. The admin sent me the list of hdisk#'s for the new disks, but I need the corresponding rhdisk# for the same hdisk. (I know from past experience that the rhdisk that maps to an hdisk is not always the same number. For instance,... (5 Replies)
Discussion started by: sbrower
5 Replies

8. Shell Programming and Scripting

Shell Script with following awk command pls help

Hi I want to create a shell script with the following awk command & also get the filenames in output. awk '/<catetcsecuretty0>/ {p=1} /<catvarlogmessages0>/ {p=0} p' *.xml As there will be multiple outputs related to many xml files I cannot identify which output belongs to which file ... (5 Replies)
Discussion started by: sharp488
5 Replies

9. UNIX and Linux Applications

Xml to csv

Hello, Does anyone know of a way to convert an .xml file (ONIX) to something more workable, like a .csv (or even .xls) file? Ideally something on the command line would be ideal, but not absolutely necessary. I would be dealing with .xml files of 125 MB+. I am using XQuartz in El Capitan. ... (17 Replies)
Discussion started by: palex
17 Replies

10. UNIX for Beginners Questions & Answers

Changing date format with script

I'm trying to change date format using this script from day/month/year to month/day/year #!/bin/bash while read line; do echo "$line" date=$(echo "$line" | cut -d/ -f1 ) month=$(echo "$line" | cut -d/ -f2 ) echo $month"/"$date"/2017" done < ~/Downloads/Dates.csv But I get output as... (5 Replies)
Discussion started by: sharat
5 Replies

11. Shell Programming and Scripting

Matching column value from 2 different file using awk and append value from different column

Hi, I have 2 csv files. a.csv HUAWEI,20LMG011_DEKET_1296_RTN-980_IDU-1-11-ISV3-1(to LAMONGAN_M),East_Java,20LMG011_DEKET_1296_RTN-980_IDU-1,20LMG011,20LMG 027_1287_LAMONGAN_RTN980_IDU1,20LMG027,1+1(HSB),195.675,20LMG011-20LMG027,99.9995,202.6952012... (7 Replies)
Discussion started by: tententen
7 Replies

12. Shell Programming and Scripting

A script need help

Hi Gurus, I have below requirement and have no idea how to achieve this. the input file like below. there are multiple sections in file, each section has multiple lines. I need to find certain lines (value1, value2, value3 are key words for line searching) and generate another file. in some... (9 Replies)
Discussion started by: green_k
9 Replies

13. Shell Programming and Scripting

Shorten header of protein sequences in fasta file to only organism name

I have a fasta file as follows >sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens OX=9606 GN=STAB2 PE=1 SV=3 MMLQHLVIFCLGLVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTM ITSGSVGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPRCCPGRWGPDCIECPGGAGSPC NGRGSCAEGMEGNGTCSCQEGFGGTACETCADDNLFGPSCSSVCNCVHGVCNSGLDGDGT... (3 Replies)
Discussion started by: jerrild
3 Replies

14. Shell Programming and Scripting

Adding sequential index to duplicate strings

I have a text file in the following format >Homo sapiens KQKCLYNLPFKRNLEGCRERCSLVIQIPRCCKGYFGRDCQACPGGPDAPCNNRGVCLDQY SATGECKCNTGFNGTACEMCWPGRFGPDCLPCGCSDHGQCDDGITGSGQCLCETGWTGPS CDTQAVLPAVCTPPCSAHATCKENNTCECNLDYEGDGITCTVVDFCKQDNGGCAKVARCS... (2 Replies)
Discussion started by: jerrild
2 Replies