PPSH(1) General Commands Manual PPSH(1)NAME
ppsh - Parse and pretty print arbitrary Haskell Show output
SYNOPSIS
ppsh
DESCRIPTION
The ppsh program takes the output of an arbitrary Haskell Show output on stdin and pretty prints it to stdout. It uses the library provided
in the libghc-pretty-show-dev package to parse the input and pretty print the output.
AUTHOR
This manual page was written by Erik de Castro Lopo <erikd@mega-nerd.com> and is released under the same license as the pretty-show pack-
age.
July 23, 2010 PPSH(1)
Check Out this Related Man Page
DH_HASKELL_PROVIDES(1) Haskell devscripts documentation DH_HASKELL_PROVIDES(1)NAME
dh_haskell_provides - calculates Haskell virtual package names on Cabalized libraries
SYNOPSIS
dh_haskell_provides [debhelper options] [-Xpackage] [--exclude=package] [file ...]
DESCRIPTION
dh_haskell_provides is a debhelper program that calculates the correct virtual package to provide, so that dependencies can guarantee ABI
stability.
For a package with an idea of package-version-longhashstring, it generates a virtual package of the form libghc-package-dev-version-longh
for the -dev package and libghc-package-prof-version-longh for the prof package respectively.
This script writes the debian/$package.substvars file, including in it the haskell:Provides. So, to use this package, include in the
Provides: field in debian/control ${haskell:Provides}.
SEE ALSO dh_haskell_depends(1)dh_haskell_shlibdeps(1)debhelper(7)AUTHOR
Joachim Breitner <nomeata@debian.org>
Based on ideas in dh_ocaml.
Haskell devscripts 0.8.12 2011-01-15 DH_HASKELL_PROVIDES(1)
Guy's
I have script doing many steps as the below ...
#############
## step1# mount all Files system
mount all
## step2# Start the application
/app/appsh
#############
but some time mount points will not be mounted completely so that will give an error if the next step started... (1 Reply)
Hi everybody,
I'm from Spain so excuse my english.
I'm Trying to Shutdown the Mitel 3300 CXI by serial port.
I'm trying to do this with the EXPECT software.
The problem is:
The connection is done.
The "shutdown" is done BUT the Mitel auto-boot if the script does not type... (0 Replies)
My HP-UX server currently mounts a directory on a Windows 2012 server. The Windows server allows anonymous connections for RW and this configuration has worked well for years. Now, due to tightening security requirements I can't use anonymous. I also can't setup Identity Mapping on the Windows... (5 Replies)
in the /etc/sudoer file this line was added:
wtolentino ALL=(ORACLE) NOPASSWD: /bin/chmod
when i tried to run this command
sudo -u oracle /bin/chmod 775 /appshared/applications/lpa/executables/chrpt001.rep
it prompts me for a password
for example:
$ pwd
/appshared/applications/lpa... (2 Replies)
I have a fasta file as follows
>sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens OX=9606 GN=STAB2 PE=1 SV=3
MMLQHLVIFCLGLVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTM
ITSGSVGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPRCCPGRWGPDCIECPGGAGSPC
NGRGSCAEGMEGNGTCSCQEGFGGTACETCADDNLFGPSCSSVCNCVHGVCNSGLDGDGT... (3 Replies)
I have a text file in the following format
>Homo sapiens
KQKCLYNLPFKRNLEGCRERCSLVIQIPRCCKGYFGRDCQACPGGPDAPCNNRGVCLDQY
SATGECKCNTGFNGTACEMCWPGRFGPDCLPCGCSDHGQCDDGITGSGQCLCETGWTGPS
CDTQAVLPAVCTPPCSAHATCKENNTCECNLDYEGDGITCTVVDFCKQDNGGCAKVARCS... (2 Replies)