Linux and UNIX Man Pages

Linux & Unix Commands - Search Man Pages

nanl(3) [mojave man page]

NAN(3)							   BSD Library Functions Manual 						    NAN(3)

NAME
nan -- generate a quiet NaN SYNOPSIS
#include <math.h> double nan(const char *tagp); long double nanl(const char *tagp); float nanf(const char *tagp); DESCRIPTION
The nan() functions return a quiet NaN, whose trailing fraction field contains the result of converting tagp to an unsigned integer. If tagp is too large to be contained in the trailing fraction field of the NaN, then the least significant bits of the integer represented by tagp are used. SPECIAL VALUES
If tagp contains any non-numeric characters, the function returns a NaN whos trailing fraction field is zero. If tagp is empty, the function returns a NaN whos trailing fraction field is zero. STANDARDS
The nan() functions conform to ISO/IEC 9899:2011. BSD
July 01, 2008 BSD

Check Out this Related Man Page

nan(3M) 						  Mathematical Library Functions						   nan(3M)

NAME
nan, nanf, nanl - return quiet NaN SYNOPSIS
cc [ flag... ] file... -lm [ library... ] #include <math.h> double nan(const char *tagp); float nanf(const char *tagp); long double nanl(const char *tagp); DESCRIPTION
The function call nan("n-char-sequence") is equivalent to: strtod("NAN(n-char-sequence)", (char **) NULL); The function call nan(" ") is equivalent to: strtod("NAN()", (char **) NULL) If tagp does not point to an n-char sequence or an empty string, the function call is equivalent to: strtod("NAN", (char **) NULL) Function calls to nanf() and nanl() are equivalent to the corresponding function calls to strtof() and strtold(). See strtod(3C). RETURN VALUES
These functions return a quiet NaN. ERRORS
No errors are defined. ATTRIBUTES
See attributes(5) for descriptions of the following attributes: +-----------------------------+-----------------------------+ | ATTRIBUTE TYPE | ATTRIBUTE VALUE | +-----------------------------+-----------------------------+ |Interface Stability |Standard | +-----------------------------+-----------------------------+ |MT-Level |MT-Safe | +-----------------------------+-----------------------------+ SEE ALSO
math.h(3HEAD), strtod(3C), attributes(5), standards(5) SunOS 5.10 1 Sep 2002 nan(3M)
Man Page

6 More Discussions You Might Find Interesting

1. Shell Programming and Scripting

sql error code trapping

Hello #!bin/ksh sqlplus -s system/manager < |grep '^ORA' |uniq select * from kk; set echo on show spool on end; / EOF save test.sh sh test.sh results ORA-00942: table or view does not exist (3 Replies)
Discussion started by: xiamin
3 Replies

2. UNIX for Dummies Questions & Answers

help!what`s the meaning of the "deltas"

i am translating <FreeBSD handbook> to Chinese.So,i have a word which i don`t kown how to describe within the professionanl field.That is "deltas".The entire sentence is "all ports being expressed as deltas to their original source." Is there anybody can explain this word in that sentence. ... (3 Replies)
Discussion started by: beijingzhzj
3 Replies

3. Shell Programming and Scripting

process field 1 depending on field 6

Hi I am abigginer to unix .I have a file which contains data like this . fiusdcanlt_fmrbgmusd1_run 07/23/2012 20:11:18 07/23/2012 20:12:20 SU 10861341/1 fiusdcanlt_fmrbgmusd2_run 07/23/2012 20:12:22 07/23/2012 20:21:26 SU 10861341/1 fiusdcanlt_fmrbgmusd3_run 07/23/2012... (7 Replies)
Discussion started by: ptappeta
7 Replies

4. UNIX for Advanced & Expert Users

Conflicts in the output of TOP command

Hi All, In the output of TOP command in my unix system, i monitored that some process has utilization more than 100% even some process has 4000% utilisation. Please help me understand how it is possible to show more than 100% utilization. Please see the screenshot below:... (2 Replies)
Discussion started by: anand2308
2 Replies

5. Shell Programming and Scripting

Matching column value from 2 different file using awk and append value from different column

Hi, I have 2 csv files. a.csv HUAWEI,20LMG011_DEKET_1296_RTN-980_IDU-1-11-ISV3-1(to LAMONGAN_M),East_Java,20LMG011_DEKET_1296_RTN-980_IDU-1,20LMG011,20LMG 027_1287_LAMONGAN_RTN980_IDU1,20LMG027,1+1(HSB),195.675,20LMG011-20LMG027,99.9995,202.6952012... (7 Replies)
Discussion started by: tententen
7 Replies

6. Shell Programming and Scripting

Shorten header of protein sequences in fasta file to only organism name

I have a fasta file as follows >sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens OX=9606 GN=STAB2 PE=1 SV=3 MMLQHLVIFCLGLVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTM ITSGSVGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPRCCPGRWGPDCIECPGGAGSPC NGRGSCAEGMEGNGTCSCQEGFGGTACETCADDNLFGPSCSSVCNCVHGVCNSGLDGDGT... (3 Replies)
Discussion started by: jerrild
3 Replies