MTD(4) BSD Kernel Interfaces Manual MTD(4)NAME
mtd -- Driver for Myson Technologies MTD803 3-in-1 Fast Ethernet board
SYNOPSIS
mtd* at pci?
DESCRIPTION
The mtd device driver supports the MTD803 PCI Ethernet chip.
Supported models include:
o Safeway Lancard SW-10/100 PCI (model 117204). Please note that some cards sold under this name are supported by rtk(4) instead.
SEE ALSO intro(4), mii(4), pci(4), rtk(4), ifconfig(8)HISTORY
The mtd driver appeared in NetBSD 2.0.
AUTHORS
Peter Bex <Peter.Bex@student.kun.nl>
BUGS
This driver has not been tested on any architecture besides i386. It does not handle DMA cache flushes at all, so it will very likely not
work on other architectures that require this.
Power management is missing.
A cardbus variant is rumored to exist, but support for it has not been added to the driver yet.
BSD November 8, 2002 BSD
Check Out this Related Man Page
MY(4) BSD Kernel Interfaces Manual MY(4)NAME
my -- Myson Technology Ethernet PCI driver
SYNOPSIS
To compile this driver into the kernel, place the following line in your kernel configuration file:
device my
Alternatively, to load the driver as a module at boot time, place the following line in loader.conf(5):
if_my_load="YES"
DESCRIPTION
The my driver provides support for various NICs based on the Myson chipset. The Myson chipset is a variant of the DEC Tulip NIC chipset.
The driver will work with almost any MII-compliant PHY, thus failure to positively identify the chip is not a fatal error.
HARDWARE
The my driver provides support for various NICs based on the Myson chipset. Supported models include:
o Myson MTD800 PCI Fast Ethernet chip
o Myson MTD803 PCI Fast Ethernet chip
o Myson MTD89X PCI Gigabit Ethernet chip
SEE ALSO altq(4), de(4), netintro(4), pci(4), ifconfig(8)HISTORY
The my driver first appeared in FreeBSD 4.6.
AUTHORS
The my driver was written by Myson Technology Inc.
This manual page was written by Hiten M. Pandya <hmp@FreeBSD.org>.
BUGS
The my driver does not support Power Management Events (PME).
BSD March 11, 2007 BSD
Hi ,
I want to pass parameters from a shell script to a sql script and use the parameter in the sql query ..and then I want to spool a particular select query on to my unix box... for 4 different locations by writing only one sql script
Right now no file is generated on the unix box...it is a... (2 Replies)
Hi , I accidentally deleted crontab entries and I need to restore back urgently ! we use a ufsdump with 0cfu option. I like to know how to restrore / retrieve to different location for crontab file only from the backup. Thanks. (4 Replies)
find ./ -name *Kconfig -exec cat {} \;
but it won't work with
find ./ -name *Kconfig -exec cat {} |grep CONFIG_MTD |grep depend \;
how could I handle this (14 Replies)
We have a SPARC T4-1 server, running Solaris 11, and it's doing some pretty extensive parsing on roughly 100GB data set.
All was well still few weeks ago, when I was testing the performance, I was reaching rougly 50minute calculation times, and it was more or less expected performance.
Now... (0 Replies)
Hi I have a text file that I want to change some of the characters based on their position. My file contain multiple lines and characters should be counted continuously line by line. For example, I want to convert the 150th T to C. What can I do? Here is a portion of my file:... (10 Replies)
Hi ,
I have a set of files in a folder which i need to cut in to two parts....
Sample files
touch AE_JUNFOR_2014_MTD_2013-05-30-03-30-02.TXT
touch AE_JUNFOR_2014_YTD_2013-05-30-03-30-02.TXT
touch temp_AE_JUNFOR_2014_MTD_2013-05-30-03-30-02.TXT
touch... (4 Replies)
OS : RHEL 6.1
Shell : Bash
I have lots of files in /tmp/stage directory as show below.
Using a loop, I need to print all the filenames in this directory except those ending with a number. How can I do this ?
# pwd
/tmp/stage
#
#
# ls -l *
-rw-r--r--. 1 root root 0 Oct 7 18:38 stmt1... (2 Replies)
hi guys.
I have an Kaon router wich runs "Linux version 3.10.24-svn1480 (jskim@jake-205) (gcc version 4.4.7 (Realtek MSDK-4.4.7 Build 1459".
The problem I have it is that its firmware is in early stages and has alot of things messed up.
Wake on lan doesn't work without arp binding and that can... (23 Replies)
I have a fasta file as follows
>sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens OX=9606 GN=STAB2 PE=1 SV=3
MMLQHLVIFCLGLVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTM
ITSGSVGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPRCCPGRWGPDCIECPGGAGSPC
NGRGSCAEGMEGNGTCSCQEGFGGTACETCADDNLFGPSCSSVCNCVHGVCNSGLDGDGT... (3 Replies)