hdid(8) BSD System Manager's Manual hdid(8)NAME
hdid -- historical mechanism for attaching disk images
SYNOPSIS
hdid [options] image
DESCRIPTION
Historically, hdid was both the tool used to attach a disk image and the user process used to load and decompress disk image data for the
hard disk image (HDI) driver in Mac OS X. hdid exists only for backwards compatibility.
As of Mac OS X 10.4, hdid invokes
hdiutil attach -agent hdid
which causes hdiutil(1) to behave like the historical hdid. For example, some of hdiutil attach's more modern behaviors (such as verifying
images which haven't been verified before) are disabled. hdiutil(1) should be used instead of hdid.
SEE ALSO hdiutil(1)OS X 16 Aug 2013 OS X
Check Out this Related Man Page
NBDST(8) BSD System Manager's Manual NBDST(8)NAME
nbdst -- NetBoot deferred shadow tool
SYNOPSIS
nbdst [-recycle | -preallocate size] devnode shadowfile
DESCRIPTION
nbdst is used during NetBoot to associate a shadow file with the disk image being used as the root device. After the shadow file is attached,
subsequent writes to the root device will be redirected to the shadow file, which normally resides on local storage. nbdst is invoked by
/etc/rc.netboot
ARGUMENTS
The following arguments must be specified:
devnode The device node of the root device, in the form "disk0"
shadowfile Path to a shadow file which will be created and associated with the NetBoot root device
OPTIONS -recycle If a shadow file already exists, reset it and use it again. Otherwise, information written to an existing shadow file will reap-
pear. Reusing a previous shadow file without resetting it requires that the shadow file be created with the same base image.
-preallocate size
Set the shadow file to the given size up front. This forces a reset of the shadow file (like -recycle).
NOTE
nbdst can only be run as root.
SEE ALSO hdiutil(1), hdik(8)Mac OS X 29 Apr 2003 Mac OS X
I have this following file and I would quite like to get it decoded - any help / advice is appreciated. I would like to know how to decrypt it, however if someone is able to do it for me I would be equally grateful.
<?php
//Obfuscation provided by FOPO - Free Online PHP Obfuscator v1.2:... (6 Replies)
I have a text file, input.fasta contains some protein sequences. input.fasta is shown below.
>P02649
MKVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQT
LSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQA
RLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY... (8 Replies)
I have a fasta file as follows
>sp|O15090|FABP4_HUMAN Fatty acid-binding protein, adipocyte OS=Homo sapiens GN=FABP4 PE=1 SV=3
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
>sp|L18484|AP2A2_RAT AP-2... (3 Replies)
I am wondering if someone can help a brother out. I am trying to create a DB using a GUI and when I am about to finish, it gets stuck. I hit finish but nothing happens. Any help from the community will be highly appreciated.
... (0 Replies)