hdid(8) BSD System Manager's Manual hdid(8)NAME
hdid -- historical mechanism for attaching disk images
SYNOPSIS
hdid [options] image
DESCRIPTION
Historically, hdid was both the tool used to attach a disk image and the user process used to load and decompress disk image data for the
hard disk image (HDI) driver in Mac OS X. hdid exists only for backwards compatibility.
As of Mac OS X 10.4, hdid invokes
hdiutil attach -agent hdid
which causes hdiutil(1) to behave like the historical hdid. For example, some of hdiutil attach's more modern behaviors (such as verifying
images which haven't been verified before) are disabled. hdiutil(1) should be used instead of hdid.
SEE ALSO hdiutil(1)OS X 16 Aug 2013 OS X
Check Out this Related Man Page
BLKCALC(1) General Commands Manual BLKCALC(1)NAME
blkcalc - Converts between unallocated disk unit numbers and regular disk unit numbers.
SYNOPSIS
blkcalc [-dsu unit_addr] [-vV] [-i imgtype] [-o imgoffset] [-b dev_sector_size] [-f fstype] image [images]
DESCRIPTION
blkcalc creates a disk unit number mapping between two images, one normal and another that only contains the unallocated units of the first
(the default behavior of the blkls(1) program). One of the -d, -s, or -u options must be given. If the -d option is given, then the
unit_addr value is the disk unit address in the regular image (i.e. from dd ). If the unit is unallocated, its address in an unallocated
image is given. If the -u option is given, then the unit_addr value is the disk unit address in the unallocated unit image (i.e. from
blkls(1) ). Its disk unit address in the original image is determined. If the -s option is given, then the unit_addr value is the disk
unit address in the slack image (i.e. from blkls -s). The image is the full, original image (i.e. from dd). blkcalc was called dcalc in
TSK versions prior to 3.0.0.
-f fstype
Identify the File System type of the image. Use '-f list' to list the supported file system types. If not given, autodetection
methods are used.
-i imgtype
Identify the type of image file, such as raw or split. Use '-i list' to list the supported types. If not given, autodetection
methods are used.
-o imgoffset
The sector offset where the file system starts in the image.
-b dev_sector_size
The size, in bytes, of the underlying device sectors. If not given, the value in the image format is used (if it exists) or
512-bytes is assumed.
-v Verbose output to STDERR.
-V Display version.
This is useful when keyword searching an image generated by blkls. This allows one to identify the original unit address and provides bet-
ter documentation.
EXAMPLE
# blkcalc -u 64 images/wd0e
SEE ALSO blkls(1),
AUTHOR
Brian Carrier <carrier at sleuthkit dot org>
Send documentation updates to <doc-updates at sleuthkit dot org>
BLKCALC(1)
I have this following file and I would quite like to get it decoded - any help / advice is appreciated. I would like to know how to decrypt it, however if someone is able to do it for me I would be equally grateful.
<?php
//Obfuscation provided by FOPO - Free Online PHP Obfuscator v1.2:... (6 Replies)
I have a text file, input.fasta contains some protein sequences. input.fasta is shown below.
>P02649
MKVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQT
LSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQA
RLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY... (8 Replies)
I have a fasta file as follows
>sp|O15090|FABP4_HUMAN Fatty acid-binding protein, adipocyte OS=Homo sapiens GN=FABP4 PE=1 SV=3
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
>sp|L18484|AP2A2_RAT AP-2... (3 Replies)
I am wondering if someone can help a brother out. I am trying to create a DB using a GUI and when I am about to finish, it gets stuck. I hit finish but nothing happens. Any help from the community will be highly appreciated.
... (0 Replies)