Linux and UNIX Man Pages

Linux & Unix Commands - Search Man Pages

hcd(1) [suse man page]

HCD(1)							      General Commands Manual							    HCD(1)

NAME
hcd - change working HFS directory SYNOPSIS
hcd [hfs-path] DESCRIPTION
hcd is used to change the notion of the "current working directory" for the current HFS volume. All subsequent HFS commands will interpret filenames relative to this directory, unless absolute pathnames are used. If the argument pathname is omitted, hcd will change to the root of the current volume. SEE ALSO
hfsutils(1), hpwd(1), hls(1) FILES
$HOME/.hcwd BUGS
Although absolute pathnames can be given to hcd, the full pathname must match the current volume; it cannot specify a path for a different volume. Use hvol or hmount to change the current volume. (Each volume has its own independent current working directory.) AUTHOR
Robert Leslie <rob@mars.org> HFSUTILS
13-Jan-1997 HCD(1)

Check Out this Related Man Page

HMOUNT(1)						      General Commands Manual							 HMOUNT(1)

NAME
hmount - introduce a new HFS volume and make it current SYNOPSIS
hmount source-path [partition-no] DESCRIPTION
hmount is used to introduce a new HFS volume. A UNIX pathname to the volume's source must be specified. The source may be a block device or a regular file containing an HFS volume image. If the source medium is partitioned, one partition must be selected to be mounted. If there is only one HFS partition on the medium, it will be selected by default. Otherwise, the desired partition number must be specified (as the ordinal nth HFS partition) on the command- line. Partition number 0 can be specified to refer to the entire medium, ignoring what might otherwise be perceived as a partition map, although in practice this is probably only useful if you want this command to fail when the medium is partitioned. The mounted volume becomes "current" so subsequent commands will refer to it. The current working directory for the volume is set to the root of the volume. This information is kept in a file named .hcwd in the user's home directory. If the source medium is changed (e.g. floppy or CD-ROM disc exchanged) after hmount has been called, subsequent HFS commands will fail until the original medium is replaced or a different volume is made current. To use the same source path with the different medium, reissue the hmount command. EXAMPLES
% hmount /dev/fd0 If a Macintosh floppy disk is available as /dev/fd0, this command makes the floppy current for other HFS commands such as hls(1), hcd(1), hcopy(1), etc. % hmount /dev/sd2 1 If a SCSI disk is available as /dev/sd2, this command finds the first HFS partition on the medium and makes it available for other HFS operations. NOTES
hmount does not actually mount an HFS partition over a UNIX directory in the traditional mount(8) sense. It is merely a "virtual" mount, as a point of convenience for future HFS operations. Each HFS command independently opens, operates on, and closes the named source path given to hmount. SEE ALSO
hfsutils(1), hformat(1), humount(1), hvol(1) FILES
$HOME/.hcwd AUTHOR
Robert Leslie <rob@mars.org> HFSUTILS
08-Nov-1997 HMOUNT(1)
Man Page

12 More Discussions You Might Find Interesting

1. AIX

Idenity no of ethernet cards on the server

How can I identify how many ethernet adapter cards I have on the server from the below ouput ? $>lsdev -Cc adapter | grep ent ent0 Available 06-08 10/100/1000 Base-TX PCI-X Adapter (14106902) ent1 Available 07-08 2-Port 10/100/1000 Base-TX PCI-X Adapter (14108902) ent2 ... (5 Replies)
Discussion started by: mk8570
5 Replies

2. UNIX for Dummies Questions & Answers

Pull out multiple lines with grep patternfile

Hi, I'm trying to get lines from a file using identifiers in the first two columns. I have used: cat MasterFile.txt | grep -f Pattern.txt and the lines I want display on screen. If I try to put them in a file the file is created but stays empty: cat MasterFile.txt | grep -f Pattern.txt... (14 Replies)
Discussion started by: FGPonce
14 Replies

3. Debian

Wlan0 Failed to UP in Kali Linux

Dear Moderator, While working on airmon-ng when the situation has come to set wlan0 on monitor mode Identification Wlan0 root@kali:~# iwconfig lo no wireless extensions. wlan0 IEEE 802.11bgn ESSID:off/any Mode:Managed Access Point: Not-Associated ... (1 Reply)
Discussion started by: raghunsi
1 Replies

4. Shell Programming and Scripting

Copy of "How to create a long list of directories with mkdir?"

To bakunin and corona688: My result when text in file is ms_ww_546 ms_rrL_99999 ms_nnn_67_756675 is https://www.unix.com/C:\Users\Fejoz\Desktop\ttt.jpg I hope you can see the picture. There is like a "whitespace character" after 2 of the 3 created directories. ---------- Post... (0 Replies)
Discussion started by: setub
0 Replies

5. UNIX for Beginners Questions & Answers

No SMS notifications once ppp up

Hi all, I have an Siemens IoT2020 with a Sim7000e cellular board that I connect via USB to the board and connect to Telstra Cat-M1 network. I can send and receive SMS and do so using Node-Red but can also do with Minicom etc. When connected I get : root@iot2000:~# dmesg | grep USB ACPI:... (0 Replies)
Discussion started by: antc
0 Replies

6. Shell Programming and Scripting

Parser ldapsearch to mysql

Hi, I'm trying to make a bash script to read LDAP (from MS active directory with ldapsearch), extract the fields 'mail', 'division', 'memberOf', 'userAccountControl', 'uidNumber', 'name', 'sAMAccountName' and save in a mysql database. I have extracted the fields with ldapsearch but I am... (2 Replies)
Discussion started by: somachibun
2 Replies

7. Shell Programming and Scripting

Need awk or Shell script to compare Column-1 of two different CSV files and print if column-1 matche

Example: I have files in below format file 1: zxc,133,joe@example.com cst,222,xyz@example1.com File 2 Contains: hxd hcd jws zxc cst File 1 has 50000 lines and file 2 has around 30000 lines : Expected Output has to be : hxd hcd jws (5 Replies)
Discussion started by: TestPractice
5 Replies

8. UNIX for Beginners Questions & Answers

Multiple lines of data?

I use this to get 8 random letters: cat /dev/urandom | tr -dc 'A-Z' | fold -w 8 | head -n 1 Result is, WLGFJFZY What I'm trying to do is get 10 lines of random letters, separated by a line and each block having ascending numbers i.e; 00 IWMTDFIM 01 KZZZCHPQ 02 YBTGFHGT 03 (4 Replies)
Discussion started by: jenny-mac
4 Replies

9. AIX

AIX system dump analysis

dear all, i have p770 aix6.1 last week, the host reboot suddenly with dump. but i don't know how to analyze the dump. I posted kdb details in the attachment. please anybody help me. #>kdb vmcore.0 /unix vmcore.0 mapped from @ 700000000000000 to @ 7000001c72c0908 START ... (13 Replies)
Discussion started by: tomato00
13 Replies

10. UNIX for Beginners Questions & Answers

Missing Modules After Compiling Kernel

I'm a little embarrassed after all these years I've never really successfully compiled my own kernel. I used this guide to make the following files: linux-headers-5.1.9_5.1.9-1_amd64.deb linux-image-5.1.9_5.1.9-1_amd64.deb linux-libc-dev_5.1.9-1_amd64.deb When I first booted into this... (4 Replies)
Discussion started by: Azrael
4 Replies

11. UNIX for Beginners Questions & Answers

CONFIG_HID=y and logitech usb mouse B185 doesn't work in 5.3.0-RC2

trying to make the best for me with 5.3.0-RC2, everthing's fine, the dell vostro 3558 does what it should - but - and here's the question: how do I get a logitech m185 (wireless mouse) to work; I googled around but couldn't fiind anything usefull; the best I get when using solaar (depreciated?) is:... (2 Replies)
Discussion started by: vanbreukelingen
2 Replies

12. Shell Programming and Scripting

Shorten header of protein sequences in fasta file to only organism name

I have a fasta file as follows >sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens OX=9606 GN=STAB2 PE=1 SV=3 MMLQHLVIFCLGLVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTM ITSGSVGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPRCCPGRWGPDCIECPGGAGSPC NGRGSCAEGMEGNGTCSCQEGFGGTACETCADDNLFGPSCSSVCNCVHGVCNSGLDGDGT... (3 Replies)
Discussion started by: jerrild
3 Replies