HCD(1) General Commands Manual HCD(1)NAME
hcd - change working HFS directory
SYNOPSIS
hcd [hfs-path]
DESCRIPTION
hcd is used to change the notion of the "current working directory" for the current HFS volume. All subsequent HFS commands will interpret
filenames relative to this directory, unless absolute pathnames are used.
If the argument pathname is omitted, hcd will change to the root of the current volume.
SEE ALSO hfsutils(1), hpwd(1), hls(1)FILES
$HOME/.hcwd
BUGS
Although absolute pathnames can be given to hcd, the full pathname must match the current volume; it cannot specify a path for a different
volume. Use hvol or hmount to change the current volume. (Each volume has its own independent current working directory.)
AUTHOR
Robert Leslie <rob@mars.org>
HFSUTILS 13-Jan-1997 HCD(1)
Check Out this Related Man Page
HMOUNT(1) General Commands Manual HMOUNT(1)NAME
hmount - introduce a new HFS volume and make it current
SYNOPSIS
hmount source-path [partition-no]
DESCRIPTION
hmount is used to introduce a new HFS volume. A UNIX pathname to the volume's source must be specified. The source may be a block device or
a regular file containing an HFS volume image.
If the source medium is partitioned, one partition must be selected to be mounted. If there is only one HFS partition on the medium, it
will be selected by default. Otherwise, the desired partition number must be specified (as the ordinal nth HFS partition) on the command-
line. Partition number 0 can be specified to refer to the entire medium, ignoring what might otherwise be perceived as a partition map,
although in practice this is probably only useful if you want this command to fail when the medium is partitioned.
The mounted volume becomes "current" so subsequent commands will refer to it. The current working directory for the volume is set to the
root of the volume. This information is kept in a file named .hcwd in the user's home directory.
If the source medium is changed (e.g. floppy or CD-ROM disc exchanged) after hmount has been called, subsequent HFS commands will fail
until the original medium is replaced or a different volume is made current. To use the same source path with the different medium, reissue
the hmount command.
EXAMPLES
% hmount /dev/fd0
If a Macintosh floppy disk is available as /dev/fd0, this command makes the floppy current for other HFS commands such as hls(1),
hcd(1), hcopy(1), etc.
% hmount /dev/sd2 1
If a SCSI disk is available as /dev/sd2, this command finds the first HFS partition on the medium and makes it available for other
HFS operations.
NOTES
hmount does not actually mount an HFS partition over a UNIX directory in the traditional mount(8) sense. It is merely a "virtual" mount, as
a point of convenience for future HFS operations. Each HFS command independently opens, operates on, and closes the named source path given
to hmount.
SEE ALSO hfsutils(1), hformat(1), humount(1), hvol(1)FILES
$HOME/.hcwd
AUTHOR
Robert Leslie <rob@mars.org>
HFSUTILS 08-Nov-1997 HMOUNT(1)
How can I identify how many ethernet adapter cards I have on the server from the below ouput ?
$>lsdev -Cc adapter | grep ent
ent0 Available 06-08 10/100/1000 Base-TX PCI-X Adapter (14106902)
ent1 Available 07-08 2-Port 10/100/1000 Base-TX PCI-X Adapter (14108902)
ent2 ... (5 Replies)
Hi,
I'm trying to get lines from a file using identifiers in the first two columns. I have used:
cat MasterFile.txt | grep -f Pattern.txt
and the lines I want display on screen. If I try to put them in a file the file is created but stays empty:
cat MasterFile.txt | grep -f Pattern.txt... (14 Replies)
Dear Moderator,
While working on airmon-ng when the situation has come to set wlan0 on monitor mode
Identification Wlan0
root@kali:~# iwconfig
lo no wireless extensions.
wlan0 IEEE 802.11bgn ESSID:off/any
Mode:Managed Access Point: Not-Associated ... (1 Reply)
To bakunin and corona688:
My result when text in file is
ms_ww_546
ms_rrL_99999
ms_nnn_67_756675
is
https://www.unix.com/C:\Users\Fejoz\Desktop\ttt.jpg
I hope you can see the picture. There is like a "whitespace character" after 2 of the 3 created directories.
---------- Post... (0 Replies)
Hi all,
I have an Siemens IoT2020 with a Sim7000e cellular board that I connect via USB to the board and connect to Telstra Cat-M1 network.
I can send and receive SMS and do so using Node-Red but can also do with Minicom etc. When connected I get :
root@iot2000:~# dmesg | grep USB
ACPI:... (0 Replies)
Hi,
I'm trying to make a bash script to read LDAP (from MS active directory with ldapsearch), extract the fields 'mail', 'division', 'memberOf', 'userAccountControl', 'uidNumber', 'name', 'sAMAccountName' and save in a mysql database.
I have extracted the fields with ldapsearch but I am... (2 Replies)
Example:
I have files in below format
file 1:
zxc,133,joe@example.com
cst,222,xyz@example1.com
File 2 Contains:
hxd
hcd
jws
zxc
cst
File 1 has 50000 lines and file 2 has around 30000 lines :
Expected Output has to be :
hxd
hcd
jws (5 Replies)
I use this to get 8 random letters:
cat /dev/urandom | tr -dc 'A-Z' | fold -w 8 | head -n 1
Result is,
WLGFJFZY
What I'm trying to do is get 10 lines of random letters, separated by a line and each block having ascending numbers
i.e;
00
IWMTDFIM
01
KZZZCHPQ
02
YBTGFHGT
03 (4 Replies)
dear all,
i have p770 aix6.1
last week, the host reboot suddenly with dump. but i don't know how to analyze the dump.
I posted kdb details in the attachment.
please anybody help me.
#>kdb vmcore.0 /unix
vmcore.0 mapped from @ 700000000000000 to @ 7000001c72c0908
START ... (13 Replies)
I'm a little embarrassed after all these years I've never really successfully compiled my own kernel. I used this guide to make the following files:
linux-headers-5.1.9_5.1.9-1_amd64.deb
linux-image-5.1.9_5.1.9-1_amd64.deb
linux-libc-dev_5.1.9-1_amd64.deb
When I first booted into this... (4 Replies)
trying to make the best for me with 5.3.0-RC2, everthing's fine, the dell vostro 3558 does what it should - but - and here's the question: how do I get a logitech m185 (wireless mouse) to work; I googled around but couldn't fiind anything usefull; the best I get when using solaar (depreciated?) is:... (2 Replies)
I have a fasta file as follows
>sp|Q8WWQ8|STAB2_HUMAN Stabilin-2 OS=Homo sapiens OX=9606 GN=STAB2 PE=1 SV=3
MMLQHLVIFCLGLVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTM
ITSGSVGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPRCCPGRWGPDCIECPGGAGSPC
NGRGSCAEGMEGNGTCSCQEGFGGTACETCADDNLFGPSCSSVCNCVHGVCNSGLDGDGT... (3 Replies)